Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MANBAL (MANBAL)

This Recombinant Human Protein MANBAL (MANBAL) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Protein MANBAL

UniProt

Q9NQG1

Expression Region

1-85

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSA EVTRKPKAAVPSVNKRPKKETKKKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO6 (Forkhead box Protein O6, FOXO6) (MaxLight 750)
MBS6456193-01 0.1 mL

FOXO6 (Forkhead box Protein O6, FOXO6) (MaxLight 750)

Sign In for Pricing
View Details
FOXO6 (Forkhead box Protein O6, FOXO6) (MaxLight 750)
MBS6456193-02 5x 0.1 mL

FOXO6 (Forkhead box Protein O6, FOXO6) (MaxLight 750)

Sign In for Pricing
View Details
8-Anilino-1-naphthalenesulfonic Acid Ammonium Salt Hydrate
sc-227126B 100 g

8-Anilino-1-naphthalenesulfonic Acid Ammonium Salt Hydrate

Sign In for Pricing
View Details
DHPS antibody
10R-3834 100 ul

DHPS antibody

Sign In for Pricing
View Details
SFPI1 Peptide - N-terminal region
orb2018749 100 µg

SFPI1 Peptide - N-terminal region

Sign In for Pricing
View Details
AURKB ORF Vector (Human) (pORF)
12870011 1.0 µg DNA

AURKB ORF Vector (Human) (pORF)

Sign In for Pricing
View Details