Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q89881

Expression Region

1-97

Origin

Influenza A virus (strain A/Gull/Massachusetts/26/1980 H13N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRSGWECRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYQQEKQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF185 Antibody
NBP1-80320 100 µL

Rabbit Polyclonal ZNF185 Antibody

Sign In for Pricing
View Details
SgK223 (A-6) Alexa Fluor® 790
sc-398164 AF790 200 µg/mL

SgK223 (A-6) Alexa Fluor® 790

Sign In for Pricing
View Details
HRC CRISPR All-in-one AAV vector set (with saCas9)(Human)
23893151 3x 1.0 µg DNA

HRC CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
RGAG1 (m) -PR
sc-152833-PR 10 µM - 20 µL

RGAG1 (m) -PR

Sign In for Pricing
View Details
Pigeon G Protein Coupled Receptor 120 ELISA Kit
MBS083479 Inquire

Pigeon G Protein Coupled Receptor 120 ELISA Kit

Sign In for Pricing
View Details
Human LA/SS-B Protein
orb611147-01 50 µg

Human LA/SS-B Protein

Sign In for Pricing
View Details