Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q89881

Expression Region

1-97

Origin

Influenza A virus (strain A/Gull/Massachusetts/26/1980 H13N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRSGWECRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYQQEKQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD1 (TEA Domain Family Member 1, AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1) (MaxLight 490)
MBS6449831-01 0.1 mL

TEAD1 (TEA Domain Family Member 1, AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1) (MaxLight 490)

Sign In for Pricing
View Details
TEAD1 (TEA Domain Family Member 1, AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1) (MaxLight 490)
MBS6449831-02 5x 0.1 mL

TEAD1 (TEA Domain Family Member 1, AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1) (MaxLight 490)

Sign In for Pricing
View Details
PCNT Antibody
OACD06328-100UL 100 µL

PCNT Antibody

Sign In for Pricing
View Details
HYI Human Over-expression Lysate
orb1339057 100 µg

HYI Human Over-expression Lysate

Sign In for Pricing
View Details
BEX3 Antibody
DF14499-01 100 µL

BEX3 Antibody

Sign In for Pricing
View Details
BEX3 Antibody
DF14499-02 200 µL

BEX3 Antibody

Sign In for Pricing
View Details