Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q89881

Expression Region

1-97

Origin

Influenza A virus (strain A/Gull/Massachusetts/26/1980 H13N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRSGWECRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYQQEKQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANTXR2 (NM_058172) Human Tagged Lenti ORF Clone
RC218589L1 10 µg

ANTXR2 (NM_058172) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant human COMMD6 protein
ATGP2769-020 20 µg

Recombinant human COMMD6 protein

Sign In for Pricing
View Details
Lentiviral human LMTK3 sgRNA gene knockout kit - Lentiviral human LMTK3 sgRNA gene knockout kit (plasmid)
GTR15398696 1 Vial

Lentiviral human LMTK3 sgRNA gene knockout kit - Lentiviral human LMTK3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
hsa-miR-6807-5p miRNA Inhibitor
MIH03576 2x 5.0 nmol

hsa-miR-6807-5p miRNA Inhibitor

Sign In for Pricing
View Details
PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (MaxLight 750)
MBS6495706-01 0.1 mL

PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (MaxLight 750)

Sign In for Pricing
View Details
PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (MaxLight 750)
MBS6495706-02 5x 0.1 mL

PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (MaxLight 750)

Sign In for Pricing
View Details