Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit c 2 (atpE2)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit c 2 (atpE2) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c 2, ATP synthase F (0) sector subunit c 2, F-type ATPase subunit c 2, F-ATPase subunit c 2, Lipid-binding protein 2

UniProt

A3PS63

Expression Region

1-83

Origin

Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPETVQIASILGAAFAVGIGSLGPALGEGRAVAAAMEAIARQPEAAGTLSRTLFVGLAM IETMAIYCLVIALLLLFANPFTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IARS2 Antibody
8C11759-AAT 50 µg

IARS2 Antibody

Sign In for Pricing
View Details
Alkyl DHAP synthase (AGPS) (158-384) Mouse Monoclonal Antibody [Clone ID: AGPS-03]
AM26765PU-N 100 µg

Alkyl DHAP synthase (AGPS) (158-384) Mouse Monoclonal Antibody [Clone ID: AGPS-03]

Sign In for Pricing
View Details
Human YIPF4 activation kit by CRISPRa
GA113469 1 Kit

Human YIPF4 activation kit by CRISPRa

Sign In for Pricing
View Details
SynaptoRedTMC2 5x1mg
#70027 5x 1 mg

SynaptoRedTMC2 5x1mg

Sign In for Pricing
View Details
Human Shugoshin (SGO1) activation kit by CRISPRa
GA115802 1 Kit

Human Shugoshin (SGO1) activation kit by CRISPRa

Sign In for Pricing
View Details
C10orf105 (NM_001168390) Human Over-expression Lysate
LC432566 20 µg

C10orf105 (NM_001168390) Human Over-expression Lysate

Sign In for Pricing
View Details