Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus vannielii Cobalt transport protein CbiN (cbiN)

This Recombinant Methanococcus vannielii Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

A6UQC5

Expression Region

1-99

Origin

Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELKHVLMIIGIIILTIAPLVMYSGLTEEDGYFGGADGAASDLIMELSPEYEPWFEPFWE PPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYDFESKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SEMA3A protein, His-tagged
SEMA3A-3850H 25 µg

Recombinant Human SEMA3A protein, His-tagged

Sign In for Pricing
View Details
Human Uterus Tumor lysate
HTL-1384 1 mg

Human Uterus Tumor lysate

Sign In for Pricing
View Details
NRX3A Polyclonal Antibody
RA33642-01 50 µL

NRX3A Polyclonal Antibody

Sign In for Pricing
View Details
NRX3A Polyclonal Antibody
RA33642-02 100 µL

NRX3A Polyclonal Antibody

Sign In for Pricing
View Details
Gelsolin (GSN) Antibody
abx225202-01 50 µL

Gelsolin (GSN) Antibody

Sign In for Pricing
View Details
Gelsolin (GSN) Antibody
abx225202-02 100 µL

Gelsolin (GSN) Antibody

Sign In for Pricing
View Details