Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus vannielii Cobalt transport protein CbiN (cbiN)

This Recombinant Methanococcus vannielii Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

A6UQC5

Expression Region

1-99

Origin

Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELKHVLMIIGIIILTIAPLVMYSGLTEEDGYFGGADGAASDLIMELSPEYEPWFEPFWE PPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYDFESKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit
MBS9922793 Inquire

Cavy Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit

Sign In for Pricing
View Details
Human PRTN3 Recombinant Protein
PPT-14773 100 µg

Human PRTN3 Recombinant Protein

Sign In for Pricing
View Details
ATP1B2 Recombinant Protein (Rat)
RP191414 100 µg

ATP1B2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3) (MaxLight 750)
MBS6293640-01 0.1 mL

DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3) (MaxLight 750)

Sign In for Pricing
View Details
DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3) (MaxLight 750)
MBS6293640-02 5x 0.1 mL

DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3) (MaxLight 750)

Sign In for Pricing
View Details
UBQLN2 (Biotin)
580653-01 50 µg

UBQLN2 (Biotin)

Sign In for Pricing
View Details