Recombinant Methanococcus vannielii Cobalt transport protein CbiN (cbiN)
This Recombinant Methanococcus vannielii Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-99.
Product Specifications
Product Name Alternative
Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN
UniProt
A6UQC5
Expression Region
1-99
Origin
Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MELKHVLMIIGIIILTIAPLVMYSGLTEEDGYFGGADGAASDLIMELSPEYEPWFEPFWE PPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYDFESKN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15163273 1 Vial
Lentiviral human BOLA1 shRNA (UAS) - Lentiviral human BOLA1 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 360657-01 50 µL
KLHL29 (Kelch-like Protein 29, Kelch Repeat and BTB Domain-containing Protein 9, KLHL29, KBTBD9, KIAA1921) discontinued
Sign In for Pricing
View Details 360657-02 100 µL
KLHL29 (Kelch-like Protein 29, Kelch Repeat and BTB Domain-containing Protein 9, KLHL29, KBTBD9, KIAA1921) discontinued
Sign In for Pricing
View Details