Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1516 (MJ1516)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1516 (MJ1516) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1516

UniProt

Q58911

Expression Region

1-99

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAMNEIELMQIKDFVKDMDKNQRIVYYEQKKKSVGIAVLLSFIIPGAGQMYLGRVGKGI ILLLTCWLIIPWIYSIYDAYKSAKDYNAQLYSIIFSKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiopoietin 2 (ANGPT2) (NM_001118888) Human Over-expression Lysate
LY426530 100 µg

Angiopoietin 2 (ANGPT2) (NM_001118888) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Interleukin 32 (IL32) ELISA Kit
RD-IL32-Hu-01 96 Tests

Human Interleukin 32 (IL32) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 32 (IL32) ELISA Kit
RD-IL32-Hu-02 48 Tests

Human Interleukin 32 (IL32) ELISA Kit

Sign In for Pricing
View Details
Mouse Cetn3 activation kit by CRISPRa
GA200701 1 Kit

Mouse Cetn3 activation kit by CRISPRa

Sign In for Pricing
View Details
Diphenyleneiodonium Sulfate
TRC-D491550-50MG 50 mg

Diphenyleneiodonium Sulfate

Sign In for Pricing
View Details
4-Pyridinecarboxaldehyde
TRC-P991455-50G 50 g

4-Pyridinecarboxaldehyde

Sign In for Pricing
View Details