Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1516 (MJ1516)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1516 (MJ1516) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1516

UniProt

Q58911

Expression Region

1-99

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAMNEIELMQIKDFVKDMDKNQRIVYYEQKKKSVGIAVLLSFIIPGAGQMYLGRVGKGI ILLLTCWLIIPWIYSIYDAYKSAKDYNAQLYSIIFSKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTLA (BTLA/1528), 1mg/mL
BNUM1528-50 1x 50 µL

BTLA (BTLA/1528), 1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800767 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human NRIP (DCAF6) activation kit by CRISPRa
GA111001 1 Kit

Human NRIP (DCAF6) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Trefoil Factor 3, Intestinal (TFF3) ELISA Kit
RD-TFF3-Mu-01 96 Tests

Mouse Trefoil Factor 3, Intestinal (TFF3) ELISA Kit

Sign In for Pricing
View Details
Mouse Trefoil Factor 3, Intestinal (TFF3) ELISA Kit
RD-TFF3-Mu-02 48 Tests

Mouse Trefoil Factor 3, Intestinal (TFF3) ELISA Kit

Sign In for Pricing
View Details
Human CUTA activation kit by CRISPRa
GA109892 1 Kit

Human CUTA activation kit by CRISPRa

Sign In for Pricing
View Details