Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma mobile ATP synthase subunit c (atpE)

This Recombinant Mycoplasma mobile ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6KI76

Expression Region

1-99

Origin

Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDLITNLALPQEVINAAGSNNGAGIGYGLVAVGAGLAMIGALGTGLGQGVSAGKAAEAV GRNPEAEAKIRLMMIIGMGIAETAAIYSLIIAILLIFVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Copb1 ELISA Kit
ELI-34016r 96 Tests

Rat Copb1 ELISA Kit

Sign In for Pricing
View Details
Rac- (2R,7S) -2,7-Dimethyl-1,4-oxazepane
FDD51506-01 50 mg

Rac- (2R,7S) -2,7-Dimethyl-1,4-oxazepane

Sign In for Pricing
View Details
Rac- (2R,7S) -2,7-Dimethyl-1,4-oxazepane
FDD51506-02 0.5 g

Rac- (2R,7S) -2,7-Dimethyl-1,4-oxazepane

Sign In for Pricing
View Details
SP5 Protein Vector (Human) (pPM-C-HA)
PV132800 500 ng

SP5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DcR2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-1694R-APC-Cy7 100 µL

DcR2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
BioDil MN
MN-10512 20 L

BioDil MN

Sign In for Pricing
View Details