Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma mobile ATP synthase subunit c (atpE)

This Recombinant Mycoplasma mobile ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6KI76

Expression Region

1-99

Origin

Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDLITNLALPQEVINAAGSNNGAGIGYGLVAVGAGLAMIGALGTGLGQGVSAGKAAEAV GRNPEAEAKIRLMMIIGMGIAETAAIYSLIIAILLIFVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLK Rabbit Polyclonal Antibody (PE-Cy5.5)
orb903298 100 µL

SLK Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Lawsone methyl ether 50mg
A22394-50 50 mg

Lawsone methyl ether 50mg

Sign In for Pricing
View Details
Rabbit Polyclonal FKBP15 Antibody [DyLight 550]
NB100-423R 0.1 mL

Rabbit Polyclonal FKBP15 Antibody [DyLight 550]

Sign In for Pricing
View Details
Rabbit Monoclonal CD28 Antibody (D665) [HRP]
NBP2-81054H 0.1 mL

Rabbit Monoclonal CD28 Antibody (D665) [HRP]

Sign In for Pricing
View Details
Herpes Simplex virus, type 1 Antibody (HRP)
35-247 1 mL

Herpes Simplex virus, type 1 Antibody (HRP)

Sign In for Pricing
View Details
NQO1 AAV Vector (Rat) (CMV)
32116106 1 µg

NQO1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details