Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C4orf34 (C4orf34)

This Recombinant Human Uncharacterized protein C4orf34 (C4orf34) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Uncharacterized protein C4orf34

UniProt

Q96QK8

Expression Region

1-99

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW MVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (NM_002055) Human Recombinant Protein
TP762317 50 µg

GFAP (NM_002055) Human Recombinant Protein

Sign In for Pricing
View Details
Slc3a2 Mouse Gene Knockout Kit (CRISPR)
KN316115LP 1 Kit

Slc3a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Androst-3-en-17-one
TRC-A638045-10MG 10 mg

Androst-3-en-17-one

Sign In for Pricing
View Details
Top2a Mouse Gene Knockout Kit (CRISPR)
KN518059 1 Kit

Top2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OTUB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]
TA501944BM 100 µL

OTUB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]

Sign In for Pricing
View Details
Romifidine Hydrochloride
TRC-R640050-25MG 25 mg

Romifidine Hydrochloride

Sign In for Pricing
View Details