Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C4orf34 (C4orf34)

This Recombinant Human Uncharacterized protein C4orf34 (C4orf34) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Uncharacterized protein C4orf34

UniProt

Q96QK8

Expression Region

1-99

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW MVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX2 (SSX2B) (NM_001164417) Human Recombinant Protein
TP328751L 1 mg

SSX2 (SSX2B) (NM_001164417) Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-AMPK alpha 1 (T183) +AMPK alpha 2 (T172) Recombinant Rabbit monoclonal Antibody
HA723603 100 µL

Phospho-AMPK alpha 1 (T183) +AMPK alpha 2 (T172) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
N-Acetyl-D-leucine
TRC-A192395-10MG 10 mg

N-Acetyl-D-leucine

Sign In for Pricing
View Details
Ddt (NM_010027) Mouse Tagged ORF Clone
MG200552 10 µg

Ddt (NM_010027) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PDK1 (N-term) Rabbit Polyclonal Antibody
AP13579PU-N 400 µL

PDK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Rectum
CR559465 5 µg

Tissue Total RNA, Rectum

Sign In for Pricing
View Details