Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C4orf34 (C4orf34)

This Recombinant Human Uncharacterized protein C4orf34 (C4orf34) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Uncharacterized protein C4orf34

UniProt

Q96QK8

Expression Region

1-99

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW MVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB8B Polyclonal Antibody
E-AB-16743-01 20 µL

RAB8B Polyclonal Antibody

Sign In for Pricing
View Details
RAB8B Polyclonal Antibody
E-AB-16743-02 60 µL

RAB8B Polyclonal Antibody

Sign In for Pricing
View Details
RAB8B Polyclonal Antibody
E-AB-16743-03 120 µL

RAB8B Polyclonal Antibody

Sign In for Pricing
View Details
RAB8B Polyclonal Antibody
E-AB-16743-04 200 µL

RAB8B Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714358 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
MPG / AAG Recombinant Rabbit monoclonal Antibody
HA751073 100 µL

MPG / AAG Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details