Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 14A (TMEM14A)

This Recombinant Bovine Transmembrane protein 14A (TMEM14A) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Transmembrane protein 14A

UniProt

P56982

Expression Region

1-99

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIGFGYAALVTFGSILGYKRRGGVLSLIAGLFVGFLAGYGAYRVSNDKRDVKLSLFTA FFLATIMGVRFKRSKKIMPAGLVAGLSLLMILRLVLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Transgelin / SM22-alpha (TAGLN/247), CF568 conjugate, 0.1mg/mL
BNC680247-500 1x 500 µL

Transgelin / SM22-alpha (TAGLN/247), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF594 conjugate, 0.1mg/mL
BNC941991-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF647 conjugate, 0.1mg/mL
BNC471706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF594 conjugate, 0.1mg/mL
BNC942197-100 1x 100 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details