Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 14A (Tmem14a)

This Recombinant Mouse Transmembrane protein 14A (Tmem14a) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Transmembrane protein 14A

UniProt

P56983

Expression Region

1-99

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIGFGYAALVTIGSVLGYKRRGGVPSLIAGLSVGLLAGYGAYRVSNDRRDVKVSLFTA FFLATIMGVRFKRSKKVMPAGLVAGLSLMMILRLVLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUS81 (NM_025128) Human Recombinant Protein
TP303373M 100 µg

MUS81 (NM_025128) Human Recombinant Protein

Sign In for Pricing
View Details
GSG1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E7]
TA811995BM 100 µL

GSG1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E7]

Sign In for Pricing
View Details
CSTF2T (NM_015235) Human Recombinant Protein
TP306973L 1 mg

CSTF2T (NM_015235) Human Recombinant Protein

Sign In for Pricing
View Details
Jurkat
ARC0374 1 Million

Jurkat

Sign In for Pricing
View Details
CD28 (T-cell-specific surface glycoprotein CD28, Tp44) (BSA & Azide Free) (MaxLight 405) discontinued
168680-AF-ML405 100 µL

CD28 (T-cell-specific surface glycoprotein CD28, Tp44) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PAQRA rabbit pAb
MBS8601175-01 0.1 mL

PAQRA rabbit pAb

Sign In for Pricing
View Details