Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 14A (Tmem14a)

This Recombinant Mouse Transmembrane protein 14A (Tmem14a) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Transmembrane protein 14A

UniProt

P56983

Expression Region

1-99

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIGFGYAALVTIGSVLGYKRRGGVPSLIAGLSVGLLAGYGAYRVSNDRRDVKVSLFTA FFLATIMGVRFKRSKKVMPAGLVAGLSLMMILRLVLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcyox1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3674503 1.0 µg DNA

Pcyox1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ATF3 3'UTR Lenti-reporter-Luc Vector
12609081 1.0 µg

ATF3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
U2 snRNP A siRNA (h)
sc-89928 10 µM

U2 snRNP A siRNA (h)

Sign In for Pricing
View Details
RG9MTD3, ID (RG9MTD3, RNA (guanine-9-) -methyltransferase domain-containing protein 3) (Azide free) (HRP) discontinued
040993-HRP 200 µL

RG9MTD3, ID (RG9MTD3, RNA (guanine-9-) -methyltransferase domain-containing protein 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Cyclin D1, ID (CCND1 Protein, Cyclin D1, Isoform CRA_c, cDNA, FLJ93625, Homo Sapiens Cyclin D1 (PRAD1: Parathyroid Adenomatosis 1) (CCND1), mRNA, Cyclin D1, PRAD1: Parathyroid Adenomatosis 1, CCND1) (AP) discontinued
C8454-01R-AP 200 µL

Cyclin D1, ID (CCND1 Protein, Cyclin D1, Isoform CRA_c, cDNA, FLJ93625, Homo Sapiens Cyclin D1 (PRAD1: Parathyroid Adenomatosis 1) (CCND1), mRNA, Cyclin D1, PRAD1: Parathyroid Adenomatosis 1, CCND1) (AP) discontinued

Sign In for Pricing
View Details
TAS-102
S8539-25mg 25 mg

TAS-102

Sign In for Pricing
View Details