Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Transmembrane protein 14A (TMEM14A)

This Recombinant Pig Transmembrane protein 14A (TMEM14A) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Transmembrane protein 14A

UniProt

P56984

Expression Region

1-99

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIGFGYAALVTFGSILGYKRRGGVPSLIAGLFVGFLAGYGAYRVSLDKRDVKLSLFTA FFLATIMGVRFKRSKKIMPAGLVAGLSLLMILRLVLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akirin1 (NM_023423) Mouse Tagged ORF Clone
MG201819 10 µg

Akirin1 (NM_023423) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS801107 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
LMNB2 Rabbit Polyclonal Antibody
R1408-4 100 µL

LMNB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D-Glyceraldehyde (>80%)
TRC-G598200-1G 1 g

D-Glyceraldehyde (>80%)

Sign In for Pricing
View Details
P.gingivalis Monoclonal Antibody
E-AB-48029-01 25 µL

P.gingivalis Monoclonal Antibody

Sign In for Pricing
View Details
P.gingivalis Monoclonal Antibody
E-AB-48029-02 100 µL

P.gingivalis Monoclonal Antibody

Sign In for Pricing
View Details