Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Transmembrane protein 14A (TMEM14A)

This Recombinant Pig Transmembrane protein 14A (TMEM14A) spans the amino acid sequence from region 1-99.

Product Specifications

Product Name Alternative

Transmembrane protein 14A

UniProt

P56984

Expression Region

1-99

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIGFGYAALVTFGSILGYKRRGGVPSLIAGLFVGFLAGYGAYRVSLDKRDVKLSLFTA FFLATIMGVRFKRSKKIMPAGLVAGLSLLMILRLVLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Halo Tag, AlpHcAbs® Rabbit antibody
HA710102 100 µg

Halo Tag, AlpHcAbs® Rabbit antibody

Sign In for Pricing
View Details
2-Chlorobenzoyl Chloride
TRC-C367250-1G 1 g

2-Chlorobenzoyl Chloride

Sign In for Pricing
View Details
NM23A (NME1) Rabbit Monoclonal Antibody
TA423730 100 µL

NM23A (NME1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Doxofylline
TRC-D557100-5G 5 g

Doxofylline

Sign In for Pricing
View Details
VEGF Recombinant Rabbit monoclonal Antibody [SP07-01]
ET1604-28-50UL 50 µL

VEGF Recombinant Rabbit monoclonal Antibody [SP07-01]

Sign In for Pricing
View Details
S-Ethylglutathione
TRC-E918500-5MG 5 mg

S-Ethylglutathione

Sign In for Pricing
View Details