Recombinant Angiopteris evecta NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic
Selected Variant
GTR19110680-01
Size: 20 µg
This Recombinant Angiopteris evecta NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic spans the amino acid sequence from region 1-100.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 4L, NADH-plastoquinone oxidoreductase subunit 4L
UniProt
A2T385
Expression Region
1-100
Origin
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MIENALILGAYLFCIGFYGLITSRNMIRALMCLELIFNAVNINFVTFSNYFDTQERKGEI FSISVIAIAAAEAAIGLSIILIIYRNRKSTRIDQFNLLKW
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682511-500 1x 500 µL
CD68 (Macrophage Marker) (C68/2511), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681481-100 1x 100 µL
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680991-100 1x 100 µL
SOX10 (SOX10/991), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
