Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A5IQI0

Expression Region

1-100

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-Methyl-2-piperidinemethanol-13C2
469436-01 1 mg

α-Methyl-2-piperidinemethanol-13C2

Sign In for Pricing
View Details
α-Methyl-2-piperidinemethanol-13C2
469436-02 2.5 mg

α-Methyl-2-piperidinemethanol-13C2

Sign In for Pricing
View Details
Tankyrase Polyclonal Antibody, PE-Cy7 Conjugated
bs-9104R-PE-Cy7-01 20 µL

Tankyrase Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Tankyrase Polyclonal Antibody, PE-Cy7 Conjugated
bs-9104R-PE-Cy7-02 100 µL

Tankyrase Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
CDC6 (CDC18L) discontinued
507925 100 µg

CDC6 (CDC18L) discontinued

Sign In for Pricing
View Details
Nck beta (NCK2) (NM_003581) Human Over-expression Lysate
LS008440-20ug 20 µg

Nck beta (NCK2) (NM_003581) Human Over-expression Lysate

Sign In for Pricing
View Details