Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A6TZA4

Expression Region

1-100

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cyclin-E1 (phospho T77) Antibody
RC-16360-01 50 μL

Recombinant Cyclin-E1 (phospho T77) Antibody

Sign In for Pricing
View Details
Recombinant Cyclin-E1 (phospho T77) Antibody
RC-16360-02 100 µL

Recombinant Cyclin-E1 (phospho T77) Antibody

Sign In for Pricing
View Details
Recombinant Cyclin-E1 (phospho T77) Antibody
RC-16360-03 1 mL

Recombinant Cyclin-E1 (phospho T77) Antibody

Sign In for Pricing
View Details
1,3-Diphenylbutane
TRC-D487300-250MG 250 mg

1,3-Diphenylbutane

Sign In for Pricing
View Details
Human CENPA activation kit by CRISPRa
GA100763 1 Kit

Human CENPA activation kit by CRISPRa

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details