Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A6TZA4

Expression Region

1-100

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moesin (MSN/492), CF640R conjugate, 0.1mg/mL
BNC400492-100 1x 100 µL

Moesin (MSN/492), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF594 conjugate, 0.1mg/mL
BNC940675-100 1x 100 µL

Cytokeratin 6 (LHK6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse CD5 Protein (aa 24-370, His Tag)
PKSM041222-01 10 µg

Recombinant Mouse CD5 Protein (aa 24-370, His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD5 Protein (aa 24-370, His Tag)
PKSM041222-02 50 µg

Recombinant Mouse CD5 Protein (aa 24-370, His Tag)

Sign In for Pricing
View Details
Compounding Hood BCHL-401
BCHL-401 1 Unit

Compounding Hood BCHL-401

Sign In for Pricing
View Details
FITC Anti-Human CD32 Antibody[IV-3]
E-AB-F1075C-01 20 Tests

FITC Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details