Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A6QET8

Expression Region

1-100

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srrm1 ORF Vector (Mouse) (pORF)
ORF058495 1.0 µg DNA

Srrm1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PAFAH1B3 (NM_001145939) Human Over-expression Lysate
LS005050 100 µg

PAFAH1B3 (NM_001145939) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit polyclonal anti-Rad51C antibody
TA353420L 500 µL

Rabbit polyclonal anti-Rad51C antibody

Sign In for Pricing
View Details
Complement Factor D, Recombinant, Rat, aa26-263, His-Tag (CFD, Adipsin C3 Convertase Activator, Endogenous Vascular Elastase, Properdin Factor D)
372731-01 20 µg

Complement Factor D, Recombinant, Rat, aa26-263, His-Tag (CFD, Adipsin C3 Convertase Activator, Endogenous Vascular Elastase, Properdin Factor D)

Sign In for Pricing
View Details
Complement Factor D, Recombinant, Rat, aa26-263, His-Tag (CFD, Adipsin C3 Convertase Activator, Endogenous Vascular Elastase, Properdin Factor D)
372731-02 100 µg

Complement Factor D, Recombinant, Rat, aa26-263, His-Tag (CFD, Adipsin C3 Convertase Activator, Endogenous Vascular Elastase, Properdin Factor D)

Sign In for Pricing
View Details
Cas3
557394-01 50 µL

Cas3

Sign In for Pricing
View Details