Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 5, mitochondrial (AIM5)

This Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 5, mitochondrial (AIM5) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 5, mitochondrial, Found in mitochondrial proteome protein 51

UniProt

A7TMN2

Expression Region

1-100

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKIWKFTSFATISSVAAASLYLYAIDKNGYYYEKSKFKQVTDRVRKLIDGDETFKYVTI DDFVSGPTQIQTRSRGETFKDLWNAEVRRTAQWIYSLGGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)
MBS2149049-01 0.1 mL

PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)
MBS2149049-02 0.2 mL

PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)
MBS2149049-03 0.5 mL

PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)
MBS2149049-04 1 mL

PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)
MBS2149049-05 5 mL

PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)
MBS2149049-06 5x 5 mL

PE-Linked Monoclonal Antibody to Galectin 8 (GAL8)

Sign In for Pricing
View Details