Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A7WZ82

Expression Region

1-100

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nedd4 activation kit by CRISPRa
GA202855 1 Kit

Mouse Nedd4 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP1 (mucin domain deleted) Monoclonal Antibody
E-AB-V1111-01 20 µL

Anti-Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP1 (mucin domain deleted) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP1 (mucin domain deleted) Monoclonal Antibody
E-AB-V1111-02 100 µL

Anti-Ebola virus EBOV (Subtype Sudan, strain Gulu) Glycoprotein/GP1 (mucin domain deleted) Monoclonal Antibody

Sign In for Pricing
View Details
Chloroform-13C
TRC-C366503-500MG 500 mg

Chloroform-13C

Sign In for Pricing
View Details
MIR6716 Human qPCR Primer Pair (MI0022550)
HP301314 200 Reactions

MIR6716 Human qPCR Primer Pair (MI0022550)

Sign In for Pricing
View Details
Phenylsuccinic Acid
TRC-P336863-250MG 250 mg

Phenylsuccinic Acid

Sign In for Pricing
View Details