Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A7WZ82

Expression Region

1-100

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H8]
TA500253BM 100 µL

GATA4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H8]

Sign In for Pricing
View Details
DUSP19 (NM_080876) Human Recombinant Protein
TP306095 20 µg

DUSP19 (NM_080876) Human Recombinant Protein

Sign In for Pricing
View Details
7-Iodoacetamidocoumarin-4-carboxylic Acid
TRC-I675250-25MG 25 mg

7-Iodoacetamidocoumarin-4-carboxylic Acid

Sign In for Pricing
View Details
2-(Acetylamino)butanoic Acid-d5
TRC-A188022-25MG 25 mg

2-(Acetylamino)butanoic Acid-d5

Sign In for Pricing
View Details
CD56 / NCAM (123A8, same as 56C04), Biotin conjugate, 0.1mg/mL
BNCB0692-100 1x 100 µL

CD56 / NCAM (123A8, same as 56C04), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein Kinase D2 (PRKD2) (C-term) Rabbit Polyclonal Antibody
AP14814PU-N 400 µL

Protein Kinase D2 (PRKD2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details