Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A7WZ82

Expression Region

1-100

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,4-Dithiane
TRC-D493830-1G 1 g

1,4-Dithiane

Sign In for Pricing
View Details
Human RNF86 (TRIM2) activation kit by CRISPRa
GA108217 1 Kit

Human RNF86 (TRIM2) activation kit by CRISPRa

Sign In for Pricing
View Details
NHP2L1 (SNU13) (NM_005008) Human Recombinant Protein
TP324143L 1 mg

NHP2L1 (SNU13) (NM_005008) Human Recombinant Protein

Sign In for Pricing
View Details
Peroxiredoxin 2 Recombinant Mouse Monoclonal Antibody [7F2-R]
HA601248 100 µL

Peroxiredoxin 2 Recombinant Mouse Monoclonal Antibody [7F2-R]

Sign In for Pricing
View Details
Tissue Protein Lysate, Liver
CP565747 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF805781 100 µg

CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI1D9]

Sign In for Pricing
View Details