Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A8Z149

Expression Region

1-100

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ligase Ligand-linker Conjugate 176
T206414-01 10 mg

E3 Ligase Ligand-linker Conjugate 176

Sign In for Pricing
View Details
E3 Ligase Ligand-linker Conjugate 176
T206414-02 50 mg

E3 Ligase Ligand-linker Conjugate 176

Sign In for Pricing
View Details
RNMT antibody
70R-4827 100 µL

RNMT antibody

Sign In for Pricing
View Details
Mgea5 3'UTR Luciferase Stable Cell Line
TU213169 1.0 mL

Mgea5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-CCXCR1/XCR1 Antibody Picoband®, PE Conjugate
A04185-1-PE 100 µg/Vial

Anti-CCXCR1/XCR1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
EPHA4 Antibody
orb2322128-01 10 µg

EPHA4 Antibody

Sign In for Pricing
View Details