Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A8Z149

Expression Region

1-100

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-17D Protein (Trx Tag)
PDEM100176-01 20 µg

Recombinant Mouse IL-17D Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17D Protein (Trx Tag)
PDEM100176-02 100 µg

Recombinant Mouse IL-17D Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17D Protein (Trx Tag)
PDEM100176-03 500 µg

Recombinant Mouse IL-17D Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17D Protein (Trx Tag)
PDEM100176-04 1 mg

Recombinant Mouse IL-17D Protein (Trx Tag)

Sign In for Pricing
View Details
Epiandrosterone ELISA Kit
K063-H1 1 Plate

Epiandrosterone ELISA Kit

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), CF488A conjugate, 0.1mg/mL
BNC882256-100 1x 100 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details