Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sp. NADH-quinone oxidoreductase subunit K 2 (nuoK2)

This Recombinant Geobacter sp. NADH-quinone oxidoreductase subunit K 2 (nuoK2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit K 2, EC= 1.6.99.5, NADH dehydrogenase I subunit K 2, NDH-1 subunit K 2

UniProt

C6E8M5

Expression Region

1-100

Origin

Geobacter sp. (strain M21)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAIENYLILSAILFAIGTIGVLTRRNAIVIFMCIELMLNAVNLTFIAFSRHLGNIDGQV FVFFVMTVAAAEAAVGLALMIAFFKNRESIDVEDVNLMKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL
BNC402078-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF568 conjugate, 0.1mg/mL
BNC682550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), 0.2mg/mL
BNUB0391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), 0.2mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL
BNC680421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL
BNC740393-500 1x 500 µL

Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details