Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

O27228

Expression Region

1-100

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMLPLVKIAPEYNLTLDPSTGMIGAALGREVIILSMDEINEQIAELEATADDLINSLDP TTTPLDSYPGREGVYLTAGKLTNMVYGFILGLIILFALLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SBC-110736 50mg
A20151-50 50 mg

SBC-110736 50mg

Sign In for Pricing
View Details
Tpd52l2 Mouse qPCR Primer Pair (NM_025482)
MP217779 200 Reactions

Tpd52l2 Mouse qPCR Primer Pair (NM_025482)

Sign In for Pricing
View Details
MS8535
T209485-01 10 mg

MS8535

Sign In for Pricing
View Details
MS8535
T209485-02 50 mg

MS8535

Sign In for Pricing
View Details
Bovine Interleukin 6 IL-6 ELISA Kit
BG-BVN11339 1 Each

Bovine Interleukin 6 IL-6 ELISA Kit

Sign In for Pricing
View Details
IFT74 Antibody
A40347-100UL 100 µL

IFT74 Antibody

Sign In for Pricing
View Details