Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q2FJ10

Expression Region

1-100

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Panc 10.05 human pancreatic adenocarcinoma cancer cell line dual-labeled with luciferase and GFP
SL550102 1 Vial

Panc 10.05 human pancreatic adenocarcinoma cancer cell line dual-labeled with luciferase and GFP

Sign In for Pricing
View Details
NLGN2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV652415 1.0 µg DNA

NLGN2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PROSER3 Rabbit Polyclonal Antibody (Fluoro647)
orb3092560 100 µg

PROSER3 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
GSTM1 (NM_146421) Human Recombinant Protein
E45H31288E1 50 µg

GSTM1 (NM_146421) Human Recombinant Protein

Sign In for Pricing
View Details
NUMB Antibody
orb1239332-01 0.02 mg

NUMB Antibody

Sign In for Pricing
View Details
NUMB Antibody
orb1239332-02 0.1 mg

NUMB Antibody

Sign In for Pricing
View Details