Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q2FJ10

Expression Region

1-100

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK7 (NM_001799) Human Mass Spec Standard
PH302736 10 µg

CDK7 (NM_001799) Human Mass Spec Standard

Sign In for Pricing
View Details
SKP1 (NM_170679) Human Mass Spec Standard
PH309385 10 µg

SKP1 (NM_170679) Human Mass Spec Standard

Sign In for Pricing
View Details
AKAP3 Blocking Peptide
MBS8222167-01 1 mg

AKAP3 Blocking Peptide

Sign In for Pricing
View Details
AKAP3 Blocking Peptide
MBS8222167-02 5 mg

AKAP3 Blocking Peptide

Sign In for Pricing
View Details
AKAP3 Blocking Peptide
MBS8222167-03 5x 5 mg

AKAP3 Blocking Peptide

Sign In for Pricing
View Details
ASCL2 Double Nickase Plasmid (m)
sc-421563-NIC 20 µg

ASCL2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details