Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q2FJ10

Expression Region

1-100

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED24 Rabbit pAb (APR27927N)
APR27927N-01 50 µL

MED24 Rabbit pAb (APR27927N)

Sign In for Pricing
View Details
MED24 Rabbit pAb (APR27927N)
APR27927N-02 100 µL

MED24 Rabbit pAb (APR27927N)

Sign In for Pricing
View Details
MED24 Rabbit pAb (APR27927N)
APR27927N-03 200 µL

MED24 Rabbit pAb (APR27927N)

Sign In for Pricing
View Details
MST1P9 ELISA Kit (Human)
OKEH02383-96W 96 Tests

MST1P9 ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF
PROTQ9EQI5-1-5ug 5 µg

Mouse recombinant CXCL7 (48-109) (C-X-C motif chemokine 7) protein, AF

Sign In for Pricing
View Details
Recombinant Human CNTN2
MBS7621994-01 0.01 mg

Recombinant Human CNTN2

Sign In for Pricing
View Details