Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q2YSV2

Expression Region

1-100

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OriCell™ Complete Medium For NCI-H526 Cell Line
CMH0-7101 500 mL

OriCell™ Complete Medium For NCI-H526 Cell Line

Sign In for Pricing
View Details
Thianthrene
sc-237089 25 g

Thianthrene

Sign In for Pricing
View Details
Human Protein Wnt-16 (WNT16) ELISA Kit
AE11151HU-01 48 Tests

Human Protein Wnt-16 (WNT16) ELISA Kit

Sign In for Pricing
View Details
Human Protein Wnt-16 (WNT16) ELISA Kit
AE11151HU-02 96 Tests

Human Protein Wnt-16 (WNT16) ELISA Kit

Sign In for Pricing
View Details
Phospho-Tau Mouse Monoclonal Antibody
orb2960607-01 50 µg

Phospho-Tau Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-Tau Mouse Monoclonal Antibody
orb2960607-02 100 µg

Phospho-Tau Mouse Monoclonal Antibody

Sign In for Pricing
View Details