Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0953 (MJ0953)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0953 (MJ0953) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0953

UniProt

Q58363

Expression Region

1-100

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLLGVIGYLAVLIKAICESWVDVVKRSINGEIHPQVIEIESIINNPTGLVLLSWSITAT PGTLVIDLIPEERKLKVAVISPRSREDIVPFEPYIKKIFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Synaptotagmin-3 Antibody (N278/16)
RHN16702 100 μg

Anti-Synaptotagmin-3 Antibody (N278/16)

Sign In for Pricing
View Details
H1FNT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0924407 1.0 µg DNA

H1FNT sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Anti-SmD1 ELISA Kit
EA-5209 96 Samples

Mouse Anti-SmD1 ELISA Kit

Sign In for Pricing
View Details
Human HS3ST3B1 knockout cell line
ABC-KH7013 1 Vial

Human HS3ST3B1 knockout cell line

Sign In for Pricing
View Details
GPR161 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0898908 1.0 µg DNA

GPR161 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Olfr1333 (m) -PR
sc-150486-PR 10 µM - 20 µL

Olfr1333 (m) -PR

Sign In for Pricing
View Details