Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter marburgensis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanothermobacter marburgensis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

Q59584

Expression Region

1-100

Origin

Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMLPLVKIAPEYNLTLDPSTGMIGAALGREVIILSMDEINEQIAALEATADDLINSLDP TTIPEGSYPGREGVYLTAGKLTNIVYGFILGLIILFALLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki 67 Monoclonal Antibody
MBS8519271-01 0.1 mg

Ki 67 Monoclonal Antibody

Sign In for Pricing
View Details
Ki 67 Monoclonal Antibody
MBS8519271-02 0.1 mL (AF635)

Ki 67 Monoclonal Antibody

Sign In for Pricing
View Details
Ki 67 Monoclonal Antibody
MBS8519271-03 0.1 mL (AF610)

Ki 67 Monoclonal Antibody

Sign In for Pricing
View Details
Ki 67 Monoclonal Antibody
MBS8519271-04 0.1 mL (AF405S)

Ki 67 Monoclonal Antibody

Sign In for Pricing
View Details
Ki 67 Monoclonal Antibody
MBS8519271-05 0.1 mL (AF405L)

Ki 67 Monoclonal Antibody

Sign In for Pricing
View Details
Ki 67 Monoclonal Antibody
MBS8519271-06 0.1 mL (AF546)

Ki 67 Monoclonal Antibody

Sign In for Pricing
View Details