Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Coiled-coil domain-containing protein 167 (ccdc167)

This Recombinant Danio rerio Coiled-coil domain-containing protein 167 (ccdc167) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q5RHZ2

Expression Region

1-100

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRTRTVKKEKISVASEIDRVEERKLQCKNSLERAEFRKRKQQLSDDDRLALEDEMTILN ERVEKYEKDLQVLRGENRRNMMLSVALLAISALFYYTFIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceruloplasmin Microplate Assay Kit
MBS4504267-01 100 Assays

Ceruloplasmin Microplate Assay Kit

Sign In for Pricing
View Details
Ceruloplasmin Microplate Assay Kit
MBS4504267-02 5x 100 Assays

Ceruloplasmin Microplate Assay Kit

Sign In for Pricing
View Details
Ceruloplasmin Microplate Assay Kit
MBS4504267-03 10x 100 Assays

Ceruloplasmin Microplate Assay Kit

Sign In for Pricing
View Details
Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone Lentiviral Particle
RC229591L4V 200 µL

Caveolin 1 (CAV1) (NM_001172897) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pygopus 2 (B-8) : m-IgG1 BP-HRP Bundle
sc-542384 1 Kit

Pygopus 2 (B-8) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
DPY19L1 Antibody - N-terminal region : HRP (ARP43554_P050-HRP)
ARP43554_P050-HRP 100 µL

DPY19L1 Antibody - N-terminal region : HRP (ARP43554_P050-HRP)

Sign In for Pricing
View Details