Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Coiled-coil domain-containing protein 167 (ccdc167)

This Recombinant Danio rerio Coiled-coil domain-containing protein 167 (ccdc167) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q5RHZ2

Expression Region

1-100

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRTRTVKKEKISVASEIDRVEERKLQCKNSLERAEFRKRKQQLSDDDRLALEDEMTILN ERVEKYEKDLQVLRGENRRNMMLSVALLAISALFYYTFIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human sSELL (Soluble L-Selectin) ELISA Kit
E-UNEL-H0306-01 5x 96 Tests

Uncoated Human sSELL (Soluble L-Selectin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human sSELL (Soluble L-Selectin) ELISA Kit
E-UNEL-H0306-02 15x 96 Tests

Uncoated Human sSELL (Soluble L-Selectin) ELISA Kit

Sign In for Pricing
View Details
Bone Sialoprotein (IBSP) (CD-BSP 108-122) Rat Monoclonal Antibody [Clone ID: IDBSP5]
AM20240PU-S 10 µg

Bone Sialoprotein (IBSP) (CD-BSP 108-122) Rat Monoclonal Antibody [Clone ID: IDBSP5]

Sign In for Pricing
View Details
PODXL Polyclonal Antibody
D-AB-10420L-01 25 µL

PODXL Polyclonal Antibody

Sign In for Pricing
View Details
PODXL Polyclonal Antibody
D-AB-10420L-02 100 µL

PODXL Polyclonal Antibody

Sign In for Pricing
View Details
Human LOC114841035 activation kit by CRISPRa
GA120101 1 Kit

Human LOC114841035 activation kit by CRISPRa

Sign In for Pricing
View Details