Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Protein-export membrane protein SecG (secG)

This Recombinant Rickettsia typhi Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q68XV2

Expression Region

1-100

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDILLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAKTVGNFLSKSTIILTT LFLINAIILANLSSKKKSNLVSKINEIEENQTDNSLPIAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SIRT6 Antibody Picoband®, Dylight550 Conjugate
A00611-3-Dylight550 100 µg

Anti-SIRT6 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
DLG3 Adenovirus (Rat)
18278056 1.0 mL

DLG3 Adenovirus (Rat)

Sign In for Pricing
View Details
Pgm2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
36511116 3x 1.0 µg

Pgm2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal BCCIP Antibody
NBP3-00296-50ul 50 µL

Rabbit Polyclonal BCCIP Antibody

Sign In for Pricing
View Details
Mouse Monoclonal MUL1 Antibody (5H6.2D5) [Alexa Fluor 647]
NBP2-31361AF647 0.1 mL

Mouse Monoclonal MUL1 Antibody (5H6.2D5) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human GTF3C5 Pre-designed siRNA Set A
SI006737A 1 Each

Human GTF3C5 Pre-designed siRNA Set A

Sign In for Pricing
View Details