Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q6GJ42

Expression Region

1-100

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGYVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1561870 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
39261066 1.0 µg DNA

RGD1561870 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZMIZ2 (NM_001300959) Human Tagged ORF Clone
RG239702 10 µg

ZMIZ2 (NM_001300959) Human Tagged ORF Clone

Sign In for Pricing
View Details
HOXB6 Protein Vector (Mouse) (pPM-C-HA)
PV189608 500 ng

HOXB6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lax1 (NM_172842) Mouse Tagged Lenti ORF Clone
MR216151L3 10 µg

Lax1 (NM_172842) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DHRS2 Adenovirus (Human)
18183051 1.0 mL

DHRS2 Adenovirus (Human)

Sign In for Pricing
View Details
PCTAIRE1 (CDK16) (NM_001170460) Human Tagged ORF Clone Lentiviral Particle
RC230293L4V 200 µL

PCTAIRE1 (CDK16) (NM_001170460) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details