Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q6GJ42

Expression Region

1-100

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGYVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TINF2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2376504 1.0 µg DNA

TINF2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MLF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1307507 1.0 µg DNA

MLF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Duck Ribosome-Inactivating Protein (RIP) ELISA Kit
MBS9925720 Inquire

Duck Ribosome-Inactivating Protein (RIP) ELISA Kit

Sign In for Pricing
View Details
Recombinant MLKL Monoclonal Antibody
AN300716L-01 50 µL

Recombinant MLKL Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant MLKL Monoclonal Antibody
AN300716L-02 100 µL

Recombinant MLKL Monoclonal Antibody

Sign In for Pricing
View Details
NDUFA5P1 Protein Lysate (Human) with C-Ha Tag
31625031 100 µg

NDUFA5P1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details