Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q6GJ42

Expression Region

1-100

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGYVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPM1 (NM_001018008) Human 3' UTR Clone
SC208932 10 µg

TPM1 (NM_001018008) Human 3' UTR Clone

Sign In for Pricing
View Details
HNRPH3 (HNRNPH3) Human shRNA Plasmid Kit (Locus ID 3189)
TR312373 1 Kit

HNRPH3 (HNRNPH3) Human shRNA Plasmid Kit (Locus ID 3189)

Sign In for Pricing
View Details
Zfp777 (NM_001109348) Rat Tagged Lenti ORF Clone
RR212768L3 10 µg

Zfp777 (NM_001109348) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MXI1 Rabbit Polyclonal Antibody (PE)
orb492216 100 µL

MXI1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ANTXR1 Antibody
CSB-PA283852-01 50 μL

ANTXR1 Antibody

Sign In for Pricing
View Details
ANTXR1 Antibody
CSB-PA283852-02 100 µL

ANTXR1 Antibody

Sign In for Pricing
View Details