Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q7A723

Expression Region

1-100

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL10 Antibody Picoband® (Dylight488 Conjugate)
A00021-Dylight488 100 µg

Anti-IL10 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
MBIP Protein Vector (Rat) (pPM-C-His)
PV281345 500 ng

MBIP Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2858R), CF640R conjugate, 0.1mg/mL
BNC402858-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2858R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 Monoclonal Antibody
MBS8519648-01 0.1 mg

HSP27 Monoclonal Antibody

Sign In for Pricing
View Details
HSP27 Monoclonal Antibody
MBS8519648-02 0.1 mL (AF635)

HSP27 Monoclonal Antibody

Sign In for Pricing
View Details
HSP27 Monoclonal Antibody
MBS8519648-03 0.1 mL (AF610)

HSP27 Monoclonal Antibody

Sign In for Pricing
View Details