Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Protein-export membrane protein SecG (secG)

This Recombinant Rickettsia conorii Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q92JF8

Expression Region

1-100

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRIT1 Rabbit Polyclonal Antibody
AP26021PU-L 200 µg

KRIT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,1,1-Trifluoro-2-iodoethane
TRC-T790400-5G 5 g

1,1,1-Trifluoro-2-iodoethane

Sign In for Pricing
View Details
2-(4-Chloro-3-nitrobenzoyl)benzoic Acid
TRC-C368435-25G 25 g

2-(4-Chloro-3-nitrobenzoyl)benzoic Acid

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF568 conjugate, 0.1mg/mL
BNC680041-100 1x 100 µL

Cytokeratin 18 (C-04), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CES2 (NM_003869) Human Over-expression Lysate
LY401274 100 µg

CES2 (NM_003869) Human Over-expression Lysate

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF488A conjugate, 0.1mg/mL
BNC881919-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details