Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Protein-export membrane protein SecG (secG)

This Recombinant Rickettsia conorii Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q92JF8

Expression Region

1-100

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SARS-CoV-2 Spike RBD Antibody, Chimeric mAb, Human IgA2 (AM130)
SPD-M196b-1mg 1 mg

Anti-SARS-CoV-2 Spike RBD Antibody, Chimeric mAb, Human IgA2 (AM130)

Sign In for Pricing
View Details
Tissue FFPE Sections, Epiglottis
CS706837 5x 5 µm

Tissue FFPE Sections, Epiglottis

Sign In for Pricing
View Details
DBF4 (NM_006716) Human Over-expression Lysate
LY402007 100 µg

DBF4 (NM_006716) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ddx3x activation kit by CRISPRa
GA201046 1 Kit

Mouse Ddx3x activation kit by CRISPRa

Sign In for Pricing
View Details
GABA B Receptor 2 (GABBR2) Mouse Monoclonal Antibody [Clone ID: N81/37]
75-125 100 µL

GABA B Receptor 2 (GABBR2) Mouse Monoclonal Antibody [Clone ID: N81/37]

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS800220 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details