Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Protein-export membrane protein SecG (secG)

This Recombinant Rickettsia conorii Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q92JF8

Expression Region

1-100

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAKTVGNFLTKSTIILTT LFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL
BNUM2383-50 1x 50 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL

Sign In for Pricing
View Details
SOX4 Human Gene Knockout Kit (CRISPR)
KN209139BN 1 Kit

SOX4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Surf4 activation kit by CRISPRa
GA204168 1 Kit

Mouse Surf4 activation kit by CRISPRa

Sign In for Pricing
View Details
Agpat2 Mouse Gene Knockout Kit (CRISPR)
KN500986 1 Kit

Agpat2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COMT Recombinant Rabbit Monoclonal Antibody [JG39-48]
ET7108-89 100 µL

COMT Recombinant Rabbit Monoclonal Antibody [JG39-48]

Sign In for Pricing
View Details
S100A16 Rabbit Polyclonal Antibody
TA369524 100 µL

S100A16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details