Recombinant Nostoc sp. Cobalt transport protein CbiN (cbiN)
This Recombinant Nostoc sp. Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-100.
Product Specifications
Product Name Alternative
Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN
UniProt
Q8YQ90
Expression Region
1-100
Origin
Nostoc sp. (strain PCC 7120 / UTEX 2576)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNQSKQSLSNWLLIGGVIALAVLPLIFVRDAEFTGADSQAEKAISEVKPGYEPWFKPLFE PPSGEVESLLFSSQAALGAGIIGYAVGLYKGRSQQQRHKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC883256-500 1x 500 µL
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
